PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_08495
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 217aa    MW: 24376.7 Da    PI: 8.7646
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_08495genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox44.82.2e-14352857
                -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                t++q+++Le+++  ++ +s+++r+eLA k++L+ r +++WF N+R + k+
  PEQU_08495  3 TPSQIDVLEKAYTVSSRLSEQMRQELALKTELSSREISMWFANKRFQGKQ 52
                89*******************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.183153IPR001356Homeobox domain
SMARTSM003891.7E-4157IPR001356Homeobox domain
CDDcd000866.54E-11247No hitNo description
SuperFamilySSF466899.41E-12253IPR009057Homeodomain-like
PfamPF000465.5E-12352IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-12352IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MKTPSQIDVL EKAYTVSSRL SEQMRQELAL KTELSSREIS MWFANKRFQG KQAHLLRESK  60
REDVHPLPIH SNPSGGGSGF VLAACHFMDS TMNEASVSER CSELIRPMGK TQVQQLMPKL  120
QKTHHELDPS VLTFMERKLG GRLIEDGPLV GMTFDPLPPG AFGSPLCSGN GISCLVQFFC  180
SFLLCSHKFL KILLIVLRVE YRILKCIKLL FGALCYM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.27e-21Homeodomain-like transcriptional regulator